Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-CF311363PSD |
| Product Type | Transmembrane Protein |
| Size | Pls inquiry other sizes |
| Uniprot No. | P95504 |
| Storage Buffer | Tris-based buffer,50% glycerol |
| Species | Prochlorothrix hollandica |
| Sequence | MQTYGSRNVDYGWWAGNSRFADRTGLWLAAHVAQASFIVLWAGAITLFEVARYTPSIPMG EQGLILIPHLAALGIGVGAGGVVVNTFPYTAIGAVHLISSFVFAFGAIFHVRFGPESIGE GSDSKFAFSWDDPKQLGLILGHHLLLLGLGAIFFVGWIRFHGVYDSTIGDVRIVSNPGAT ILSVIFEYGWFTPEHNPFFVNNLEDLASGHAFIGVVLLSGGVWHITQEPFAWAQRLLASL FSAEGLLSSALAGLSMLGFAAAYFSAVNTLAYPIEFFGPPLELQFNIMPYFVDSVDLPAG VYSARAWLCNVHFYLAFFVLQGHLWHAIRAIGFDFKKVSNAFATLSN |
| Source | in vitro E.coli expression system |
| Gene Names | pcbB |
| Protein Names | Recommended name: Chlorophyll a/b light-harvesting protein pcbB |
| Expression Region | 1-347 |
| Tag Info | N-terminal 10xHis-tagged |
| Protein Description | full length protein |
| Storage | Store at -20°C, for extended storage, conserve at -20°C or -80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | The antenna complex functions as a light receptor, it captures and delivers excitation energy to photosystems II and I. The Prochlorales pcb genes are not related to higher plant LHCs. |
| Subcellular Location | Cellular thylakoid membrane, Multi-pass membrane protein |
| Protein Families | PsbB/PsbC family, IsiA/Pcb subfamily |
pcbB Proteins for Prochlorothrix hollandica
| Code | Product Name | Source |
|---|---|---|
| CSB-YP311363PSD1 CSB-EP311363PSD1 CSB-BP311363PSD1 CSB-MP311363PSD1 |
Recombinant Chlorophyll a/b light-harvesting protein pcbB(pcbB),partial | Yeast E.coli Baculovirus Mammalian cell |
Recombinant Mouse Complement C1q subcomponent subunit A(C1qa)
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Mouse Interleukin-2 receptor subunit beta(Il2rb),partial
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Human Tumor necrosis factor ligand superfamily member 6(FASLG),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Nuclear cap-binding protein subunit 2(NCBP2)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Rat Suppressor of cytokine signaling 3(Socs3)
Express system: Yeast
Species: Rattus norvegicus (Rat)
Recombinant Human Bcl-2-like protein 11(BCL2L11)
Express system: Yeast
Species: Homo sapiens (Human)
