Recombinant Choristoneura fumiferana nuclear polyhedrosis virus Occlusion-derived virus envelope protein E56(ODVP6E)

Code CSB-CF328292CJU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P41718
Storage Buffer Tris-based buffer,50% glycerol
Species Choristoneura fumiferana nuclear polyhedrosis virus (CfMNPV)
Sequence MSTFFTNLRRVNKVYPNQATFLTDNTRLLTTTPAGFTNVLRAPSTRNLGNGRFEPGYNLS NNQFVSAGDINRITRGNDVPRIRNVFQGISDPQIGSLNQLRRADNVPDAGLHVKRTRSDA VKQNFPETNVRSADGVDRALQQNPRLNTYLQGAKTAGVGVLLAGGAYLTFSAATLVQDII QALNNTGGSYYVRGADGGDTADACLLLSRTCQRDPNMNTSDVVICNHDPLIADTAQLQAI CSGFNYQQEQTVCRQSDPAADPDSPQFVDVSDLLPGQTIMCIEPYNLGDLIGDLGLDHLL GEDGLVGKSSNSSDSVSNKLMPLIWLIGAVLFLGLIIYLIYRFVIKGGAGAAGAARAPPV IVLPPPPTQQTYNSTKQQI
Source in vitro E.coli expression system
Gene Names ODVP6E
Protein Names Recommended name: Occlusion-derived virus envelope protein E56 Short name= ODV-E56 Alternative name(s): ODVP-6E
Expression Region 1-379
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Structural protein that is specific for occlusion-derived virus (ODV) envelopes but not of budded virus (BV).
Subcellular Location Virion membrane, Multi-pass membrane protein
Protein Families Baculoviridae E56 family
Database Links

KEGG: vg:1482724

Related Products

ODVP6E Proteins

ODVP6E Proteins for Choristoneura fumiferana nuclear polyhedrosis virus (CfMNPV)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.