Code | CSB-CF328292CJU |
Size | Pls inquire other sizes |
Source | in vitro E.coli expression system |
Target Names | ODVP6E |
Uniprot No. | P41718 |
Species | Choristoneura fumiferana nuclear polyhedrosis virus (CfMNPV) |
Expression Region | 1-379 |
Target Protein Sequence | MSTFFTNLRRVNKVYPNQATFLTDNTRLLTTTPAGFTNVLRAPSTRNLGNGRFEPGYNLS NNQFVSAGDINRITRGNDVPRIRNVFQGISDPQIGSLNQLRRADNVPDAGLHVKRTRSDA VKQNFPETNVRSADGVDRALQQNPRLNTYLQGAKTAGVGVLLAGGAYLTFSAATLVQDII QALNNTGGSYYVRGADGGDTADACLLLSRTCQRDPNMNTSDVVICNHDPLIADTAQLQAI CSGFNYQQEQTVCRQSDPAADPDSPQFVDVSDLLPGQTIMCIEPYNLGDLIGDLGLDHLL GEDGLVGKSSNSSDSVSNKLMPLIWLIGAVLFLGLIIYLIYRFVIKGGAGAAGAARAPPV IVLPPPPTQQTYNSTKQQI |
Protein Length | full length protein |
Tag Info | The following tags are available. N-terminal 10xHis-tagged The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
|
Form | Lyophilized powder |
Buffer before Lyophilization | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet | Please contact us to get it. |
Still Have Questions? | Start a Chat |
Function | Structural protein that is specific for occlusion-derived virus (ODV) envelopes but not of budded virus (BV). |
Subcellular Location | Virion membrane, Multi-pass membrane protein |
Protein Families | Baculoviridae E56 family |
Database Links |
KEGG: vg:1482724 |
Recombinant Human T-complex protein 1 subunit beta(CCT2)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Atrial natriuretic peptide receptor 1(NPR1),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Mouse L-dopachrome tautomerase(Dct),partial
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Human Ras-related protein Rab-10(RAB10),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Oxytocin-neurophysin 1(OXT),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human 60S acidic ribosomal protein P0(RPLP0)
Express system: E.coli
Species: Homo sapiens (Human)