Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-CF328292CJU |
| Product Type | Transmembrane Protein |
| Size | Pls inquiry other sizes |
| Uniprot No. | P41718 |
| Storage Buffer | Tris-based buffer,50% glycerol |
| Species | Choristoneura fumiferana nuclear polyhedrosis virus (CfMNPV) |
| Sequence | MSTFFTNLRRVNKVYPNQATFLTDNTRLLTTTPAGFTNVLRAPSTRNLGNGRFEPGYNLS NNQFVSAGDINRITRGNDVPRIRNVFQGISDPQIGSLNQLRRADNVPDAGLHVKRTRSDA VKQNFPETNVRSADGVDRALQQNPRLNTYLQGAKTAGVGVLLAGGAYLTFSAATLVQDII QALNNTGGSYYVRGADGGDTADACLLLSRTCQRDPNMNTSDVVICNHDPLIADTAQLQAI CSGFNYQQEQTVCRQSDPAADPDSPQFVDVSDLLPGQTIMCIEPYNLGDLIGDLGLDHLL GEDGLVGKSSNSSDSVSNKLMPLIWLIGAVLFLGLIIYLIYRFVIKGGAGAAGAARAPPV IVLPPPPTQQTYNSTKQQI |
| Source | in vitro E.coli expression system |
| Gene Names | ODVP6E |
| Protein Names | Recommended name: Occlusion-derived virus envelope protein E56 Short name= ODV-E56 Alternative name(s): ODVP-6E |
| Expression Region | 1-379 |
| Tag Info | N-terminal 10xHis-tagged |
| Protein Description | full length protein |
| Storage | Store at -20°C, for extended storage, conserve at -20°C or -80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Structural protein that is specific for occlusion-derived virus (ODV) envelopes but not of budded virus (BV). |
| Subcellular Location | Virion membrane, Multi-pass membrane protein |
| Protein Families | Baculoviridae E56 family |
| Database Links |
KEGG: vg:1482724 |
ODVP6E Proteins for Choristoneura fumiferana nuclear polyhedrosis virus (CfMNPV)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP328292CJU1 CSB-EP328292CJU1 CSB-BP328292CJU1 CSB-MP328292CJU1 |
Recombinant Choristoneura fumiferana nuclear polyhedrosis virus Occlusion-derived virus envelope protein E56(ODVP6E),partial | Yeast E.coli Baculovirus Mammalian cell |
Recombinant Human Transcriptional enhancer factor TEF-1(TEAD1)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Bifunctional Epoxide hydrolase 2(EPHX2)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Inositol-trisphosphate 3-kinase B(ITPKB)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Rat Thyrotropin subunit beta(Tshb)
Express system: Yeast
Species: Rattus norvegicus (Rat)
Recombinant Human 40S ribosomal protein SA(RPSA),partial
Express system: Yeast
Species: Homo sapiens (Human)
