Recombinant Chromobacterium violaceum UPF0761 membrane protein CV_0810(CV_0810)

Code CSB-CF742367CKA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q7NZV9
Storage Buffer Tris-based buffer,50% glycerol
Species Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)
Sequence MPPLLRGGFGITFAAMQVQRLEPYFGFARFIARRMSCLRVLQISGSLTFTTLLALVPLFT IALSVISAFPVFSDYSTRFKIMLLSTLVPEFAGKVITVYMRQFADNAEKLTAAGIVMLGV TALMLMSTIERTFNAIWGVRRGRPWLQQSMVYWTVLTLGPLVLGGSLLSWRWLFKATRLE KNLPLLASVLEAGGTIVLTALVLALLYRIVPNRFVPFRHAVWGALVTSVLLELTKMGFGF YIGQVASYQLVYGAFASIPIFLLWVYCLWLVVLAGAVFTSALSYWEGDAWRRRNEPHRRF QDALEVLLLLDAAHARGEALTPRQLRQQVKVGYDELGLVLDRLAQRGYVQKGHGDAWVLM RRAAAINLSDLFQIFVYRRDASAGDALDATLAELLGPLTEQLQAVTVADLARRVGRK
Source in vitro E.coli expression system
Gene Names CV_0810
Protein Names Recommended name: UPF0761 membrane protein CV_0810
Expression Region 1-417
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families UPF0761 family
Database Links

KEGG: cvi:CV_0810

STRING: 243365.CV_0810

Related Products

CV_0810 Proteins

CV_0810 Proteins for Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.