Recombinant Clostridium acetobutylicum ATP synthase subunit c(atpE)

Code CSB-CF517034DUB
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O08310
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787)
Sequence MNIDSHTFLLGMQYLGAGLAAIGCIGGGVGIGTVTGKAVEAIGRQPESASKVMPTMIMGL AFAEVTSLYALFVAIMLLFVK
Source in vitro E.coli expression system
Gene Names atpE
Protein Names Recommended name: ATP synthase subunit c Alternative name(s): ATP synthase F(0) sector subunit c F-type ATPase subunit c Short name= F-ATPase subunit c Lipid-binding protein
Expression Region 1-81
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families ATPase C chain family
Database Links

KEGG: cac:CA_C2870

STRING: 272562.CA_C2870

Related Products

atpE Proteins

atpE Proteins for Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.