Recombinant Cricetulus griseus Post-GPI attachment to proteins factor 3(PGAP3)

Code CSB-CF017789DXU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A2V7M9
Storage Buffer Tris-based buffer,50% glycerol
Species Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)
Sequence SQGDREPVYRDCVLRCEERNCSGDALKHFRSLQPIYMSLAGWTCRDDCKYECMWITVGLY LQEGHRVPQFHGKWPFSRFLFIQEPASAVASLLNGLASLVMLCRYRASVPASSPMYHTCM AFAWVSLNAWFWSTVFHTRDTDLTEKMDYFCASAVILHSIYLCCVRTVGLQHPSVARAFG ATLLLMLLLHTSYLSLVRFDYSYNMMANVAIGLVNLAWWLAWCLRNHRRLPHTRKCVAVV LLLQGLSLLELLDFPPLFWVLDAHAIWHISTIPVHVLFFRFLEDDSLYLLKESEAKFKLD
Source in vitro E.coli expression system
Gene Names PGAP3
Protein Names Recommended name: Post-GPI attachment to proteins factor 3 Alternative name(s): PER1-like domain-containing protein 1
Expression Region 21-320
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in the lipid remodeling steps of GPI-anchor maturation. Lipid remodeling steps consist in the generation of 2 saturated fatty chains at the sn-2 position of GPI-anchors proteins. Required for phospholipase A2 activity that removes an acyl-chain at the sn-2 position of GPI-anchors during the remodeling of GPI.
Subcellular Location Golgi apparatus membrane, Multi-pass membrane protein, Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families PGAP3 family
Database Links

KEGG: cge:100689454

Related Products

PGAP3 Proteins

PGAP3 Proteins for Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.