Recombinant Cronobacter sakazakii Electron transport complex protein RnfG(rnfG)

Code CSB-CF417712CXL
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A7MML1
Storage Buffer Tris-based buffer,50% glycerol
Species Cronobacter sakazakii (strain ATCC BAA-894) (Enterobacter sakazakii)
Sequence MLKTIQKHGVTLAVFAALTTGLTAMVNALTKTTIEGQAALQQKQLFDQVLPPEMYDNDIQ QSCYLVSAPALGRGEKQLWVARKGDTPVAVVMQATAPDGYSGAIQLLVGADFKGTVLGTR VTEHHETPGLGDKIETRISDWITGFAGQVIHGPNDTRWAVKKDGGQFDQFTGATITPRAV VNAVKRAGLYAQTLEPQLSTLPSCGENP
Source in vitro E.coli expression system
Gene Names ESA_01990
Protein Names Recommended name: Electron transport complex protein RnfG
Expression Region 1-208
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Part of a membrane complex involved in electron transport.
Subcellular Location Cell inner membrane
Protein Families RnfG family
Database Links

KEGG: esa:ESA_01990

STRING: 290339.ESA_01990

Related Products

ESA_01990 Proteins

ESA_01990 Proteins for Cronobacter sakazakii (strain ATCC BAA-894) (Enterobacter sakazakii)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.