Recombinant Cronobacter sakazakii UPF0114 protein ESA_00283 (ESA_00283)

Code CSB-CF418429CXL
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A7MNC8
Storage Buffer Tris-based buffer,50% glycerol
Species Cronobacter sakazakii (strain ATCC BAA-894) (Enterobacter sakazakii)
Sequence MERFIENAMYASRWLLAPVYFGLSLALLALTVKFFQEIIHVLPNILTIAEADLILLLLSL VDMTLVGGLLVMVMFSGYENFVSQLDIHEGKEKLSWLGKMDASSLKNKVAASIVAISSIH LLRVFMDAKNVPDNKLMWYVIIHLTFVLSAFVMGYLDKISRSKGY
Source in vitro E.coli expression system
Gene Names ESA_00283
Protein Names Recommended name: UPF0114 protein ESA_00283
Expression Region 1-165
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families UPF0114 family
Database Links

KEGG: esa:ESA_00283

STRING: 290339.ESA_00283

Related Products

ESA_00283 Proteins

ESA_00283 Proteins for Cronobacter sakazakii (strain ATCC BAA-894) (Enterobacter sakazakii)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.