Recombinant Cryptococcus neoformans var. neoformans serotype D 3-ketodihydrosphingosine reductase TSC10(TSC10)

Code CSB-CF316182CTL
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P0CR36
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) (Filobasidiella neoformans)
Sequence MPTPLALLLSAILIIGTYFAMPFWPFRKSNYDPRGKHCYITGGSSGLGKALAERLVKQGA HVTIVGRDSKKAEGVVEELKAIAAPGQIIQCIAADLTSPIASTNAIHAACKPHADQAPDY VYLCAGFSRPKLFVETTKQELKDGLDGVYWVSAYTAHEACQMMSKQRRTGKIIFVASFLS YVSFAGYSSYSPAKYALRGLSDALRSEMLLHNIDIHIFLPCGISGPGFDAENRTKPAVTK KIEEGDTPITPDVCAAALESGLKKGYYQITDNLVTEPIRLRSNGGVPTNNFLLDTLWLIV SSVGVPIWRMTADSAVRSFRAKVEKELEAKGYYVS
Source in vitro E.coli expression system
Gene Names TSC10
Protein Names Recommended name: 3-ketodihydrosphingosine reductase TSC10 EC= 1.1.1.102 Alternative name(s): 3-dehydrosphinganine reductase KDS reductase
Expression Region 1-335
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalyzes the reduction of 3-ketodihydrosphingosine (KDS) to dihydrosphingosine (DHS).
Subcellular Location Endoplasmic reticulum membrane, Single-pass membrane protein
Protein Families Short-chain dehydrogenases/reductases (SDR) family
Database Links

KEGG: cne:CNG00270

STRING: 214684.XP_571760.1

UniGene: Fne.182

Related Products

TSC10 Proteins

TSC10 Proteins for Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) (Filobasidiella neoformans)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.