Recombinant Cryptococcus neoformans var. neoformans serotype D GPI inositol-deacylase(BST1)

Code CSB-CF017839CTK
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P0CM51
Storage Buffer Tris-based buffer,50% glycerol
Species Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) (Filobasidiella neoformans)
Sequence MPAWPRFMSLRRQYLYKALDKNHQKHPIKHPHTRFLSRLFCALAVLFSYSIYQSFRTDLK QSGSWGCEMSWMSPSYRRLEWTEFISTRYALYLYREQGLDSEDTLSGHPVLFVPGNAGSY QQVRSIASSASKQYYEQVKARERNVVTGKKIDFFTADLKEEFSAFHARTVREQAVFIQHC IKGILQEYTHLPQEKRPTQVTLLAHSMGGVVARLAMDPITSISVDIIVTLSTPHILPPLA LERDMDSIYSLIRWRRQHISTHPPLISICGGISDTQIVSDSCALPFFQAGNNSDIAVFTT GIPGVWTAVEHQAIIWCHQIRWRIARMLLDMSSRANTTAKLVTAKEWLLDYQEDETLKEP RSERQHDYSVSSRNMTFIGLHQPSKAFVAQQCNGLERCRTVPSVMSLLPFPNNPSDPFPL PGEGIKPSEVMLVAEISLSSTNTVVKINASQYGQTIAGSREHHLVKGNSWSEFTITMRYR YIRIQLLFCIRPTHTSTFSFYCGTLLTLPRQSWHLSGDISIALMSCTTGVAQKKLLQRTG QICDSVPYGRSCMASRVGCCGSSVSIIRFYQHRSVRTCKGFKLILVGEILSWNSALERIA RRRMPICIVLLLLGATIQSQLPDFPMLHTFFLGVNQLEMVPLVGILGVWTFGLLCVVSFH LISTCAIFTTLLIPFKILHVAIWSRNIWTGSAALVSTDNNFYYAIPPALLVKCASCGGTI QKRHVCLKACRIALIILIMSSFSVGARWTWILSPIANAVLILFVASII
Source in vitro E.coli expression system
Gene Names BST1
Protein Names Recommended name: GPI inositol-deacylase EC= 3.1.-.-
Expression Region 1-768
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in inositol deacylation of GPI-anchored proteins which plays important roles in the quality control and ER-associated degradation of GPI-anchored proteins.
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families GPI inositol-deacylase family
Database Links

KEGG: cnb:CNBF1710

STRING: 283643.XP_775008.1

Related Products

BST1 Proteins

BST1 Proteins for Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) (Filobasidiella neoformans)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.