Recombinant Cyanothece sp. ATP synthase subunit c(atpE)

Code CSB-CF483136DZZ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. B7KKR8
Storage Buffer Tris-based buffer,50% glycerol
Species Cyanothece sp. (strain PCC 7424) (Synechococcus sp. (strain ATCC 29155))
Sequence MDPMLASASVIAAALAVGLAAIGPGIGQGNASGQAVSGIARQPEAEGKIRGTLLLTLAFM ESLTIYGLVISLVLLFANPFA
Source in vitro E.coli expression system
Gene Names atpE
Protein Names Recommended name: ATP synthase subunit c Alternative name(s): ATP synthase F(0) sector subunit c F-type ATPase subunit c Short name= F-ATPase subunit c Lipid-binding protein
Expression Region 1-81
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation.
Subcellular Location Cellular thylakoid membrane, Multi-pass membrane protein
Protein Families ATPase C chain family
Database Links

KEGG: cyc:PCC7424_2623

STRING: 65393.PCC7424_2623

Related Products

atpE Proteins

atpE Proteins for Cyanothece sp. (strain PCC 7424) (Synechococcus sp. (strain ATCC 29155))

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.