Recombinant Cyanothece sp. Cytochrome b559 subunit alpha(psbE)

Code CSB-CF487398DZZ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. B7KH62
Storage Buffer Tris-based buffer,50% glycerol
Species Cyanothece sp. (strain PCC 7424) (Synechococcus sp. (strain ATCC 29155))
Sequence MSGTTGERPFSDIVTSIRYWVIHSITIPMLFVAGWLFVSTGLAYDVFGTPRPDEYYTQER LELPILKDRYNTDQQIQEFNK
Source in vitro E.coli expression system
Gene Names psbE
Protein Names Recommended name: Cytochrome b559 subunit alpha Alternative name(s): PSII reaction center subunit V
Expression Region 1-81
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function This b-type cytochrome is tightly associated with the reaction center of photosystem II (PSII). PSII is a light-driven water
Subcellular Location Cellular thylakoid membrane, Single-pass membrane protein
Protein Families PsbE/PsbF family
Database Links

KEGG: cyc:PCC7424_0815

STRING: 65393.PCC7424_0815

Related Products

psbE Proteins

psbE Proteins for Cyanothece sp. (strain PCC 7424) (Synechococcus sp. (strain ATCC 29155))

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.