Recombinant Cydia pomonella granulosis virus Occlusion-derived virus envelope protein E56(odv-e56)

Code CSB-CF731311EQA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q66209
Storage Buffer Tris-based buffer,50% glycerol
Species Cydia pomonella granulosis virus (isolate Mexico/1963) (CpGV) (Cydia pomonella granulovirus)
Sequence MSFFRGLRRTNKVYNDPSGFITDHAQLIRNQTPAGFNLNNPTTMGLANGTYVPGYNINGA FISNTNVNTVLRNNDVVGMRQLFPDASNNQMNGLTNLRRADNIPDATLHGLQTRKNGVKT SHPETAVRDRVGVENALAQNPRLADYLRGAGYVTLFGVSVYLVINVADLVSSIVEALNRT GGSWYYRGNNGGDNFSNIDACVLRYRSCGMSLADIDEFVCELDPHDPNNVDPLLSFDEAR NFCNGYSLAAEGSVCRGSDTNADPSTLQYLDISELEPNQTVQCVEPYDFGDLIGDLGLDW LLGENGFVTASSNSLTSVSNNFTTILLVIGGILLLTFIGFVIFKVVNRSSNNNTS
Source in vitro E.coli expression system
Gene Names odv-e56
Protein Names Recommended name: Occlusion-derived virus envelope protein E56 Short name= ODV-E56 Alternative name(s): ODVP-6E
Expression Region 1-355
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Structural protein that is specific for occlusion-derived virus (ODV) envelopes but not of budded virus (BV).
Subcellular Location Virion membrane, Multi-pass membrane protein
Protein Families Baculoviridae E56 family
Database Links

KEGG: vg:921349

Related Products

odv-e56 Proteins

odv-e56 Proteins for Cydia pomonella granulosis virus (isolate Mexico/1963) (CpGV) (Cydia pomonella granulovirus)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.