Recombinant Dictyostelium discoideum Cyclic AMP receptor-like protein A(crlA)

Code CSB-CF681744DKK
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q54U75
Storage Buffer Tris-based buffer,50% glycerol
Species Dictyostelium discoideum (Slime mold)
Sequence MIQILLSTFISFIIIIVSSNDIRSGENDNFNNNKMINNFLTTITTNDTIIIKETESPNDY DFSKEQIESLDKIVYFSSTMGIVGALFIIVSFFLFKAARTFATKMIFFLSLSDLFAAIFY LPYYRDSDIMCNLQGMGLVFFLSSSYLWTMCISISLFMVFFTTIFELNHWFKYFHFICWG IPLFTAIISLIFHAYGKTGSWCFISDPTSIFRLLYYLPLIVVFFINLVVFIAIRWKISQH SNSLVSRVNIIVSFYLIAFSLSQLPTIINSIQNFSDPDNPQFSLFAFQLLLQPLQGFLNC VVYGINEGFINHYVEFFEKYIFRCRCRKSRELKEIESDKTSLLVDYENSDDEEGFDGMDK LIIDDYNRV
Source in vitro E.coli expression system
Gene Names crlA
Protein Names Recommended name: Cyclic AMP receptor-like protein A
Expression Region 1-369
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for cAMP which may play a role in prestalk cell differentiation. May act as a negative regulator of cell growth.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 5 family
Database Links

KEGG: ddi:DDB_G0280983

STRING: 44689.DDB0215007

Related Products

crlA Proteins

crlA Proteins for Dictyostelium discoideum (Slime mold)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.