Recombinant Dictyostelium discoideum Metabotropic glutamate receptor-like protein D(grlD)

Code CSB-CF684612DKK
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q54L53
Storage Buffer Tris-based buffer,50% glycerol
Species Dictyostelium discoideum (Slime mold)
Sequence EPEKKFKLITLLAAHVQDLGFNNMVNRGHVEVSKAMKLEDSQAIVVVGYNDTIRILAPLV AVGDVDLVICSSQDHAQACRELATKYKGSSIKTQFLVRGSGEATSNLITYSYNYANANYI SGYFAGLYTKTNKIGFLSPGAIDNNNDSFVYAFWYGAKRANPDISFYYYNIGNYLNPDKT VAATKDLLDMGCDMVADTLNDFSTGNTLIANNRKTAMGTSGFPQRDVYGEDVIYSYNYNW FKLFYPVAQSVYSGNTNNTNWYADFNLNETISFFGLSFSFTVPNETLTKFYEELDYLKRT PRLSHPYFCNDLMYEYAKKNHLTMSTNDSTHCLANSQFTRINAPFPGMTWLGNYEITLTE VYQSRPIQIAISSISSFFIVTVLVMMGLVVRFRKNPSIRSASPIFLNFILFGALIIYVGI IIWSSSINSASCNAQFWLVTLGFTTLIGSLVVKNVRIWLIFDNPELKLVKITNLQLVPWV GVCLVINIILMSILTSVGDLREVNAQGIDSLGKYEFMRICKMNSSGASTLYTILAYFAAL LLIGVFVSWKIRIVDILEFNESKAIANTLYAISFCLFVIVPLMISPQDKQSEKIILCIAG LFIVTAAVLIIFVPKFYRVYIFGSGGTSDMFYKKKKQSPVATARAESTSKGSSGGGAGSG GATGGSGVKTNKRGNLVSGDFSDDTESSLSEPNKPVKVVAGAVLAEFTDDTISDLDNIDQ PIEIITENGQDSNNNNNNEENKDNNIENNKISEEIKENLKNEENNDGDN
Source in vitro E.coli expression system
Gene Names grlD
Protein Names Recommended name: Metabotropic glutamate receptor-like protein D
Expression Region 23-791
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families BMP lipoprotein family; G-protein coupled receptor 3 family, GABA-B receptor subfamily
Database Links

KEGG: ddi:DDB_G0286895

Related Products

grlD Proteins

grlD Proteins for Dictyostelium discoideum (Slime mold)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.