Recombinant Dictyostelium discoideum Mitochondrial substrate carrier family protein R(mcfR)

Code CSB-CF690674DKK
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q54QI8
Storage Buffer Tris-based buffer,50% glycerol
Species Dictyostelium discoideum (Slime mold)
Sequence MTVHGNTKTSPMVTLLAGGVSGVIAKSTIAPLERVKILYQVKSKMYSFNSVYGLMKNIIK NEGLAGLWKGNTATILRIFPYSAIQWTSYDYLKNNFVTDKKSSVQIFIAGSLGFSCAILL TYPLDVIRARLALSYSNNNNNNSINSKNLNSSTQPPKVLKNGIGAVNIEKSIDFNGYKTK GLFKGIWRGILPTLYGSIPYAGVGYSSFEYFKRIAPDSFRNEKGDVIGIYKLISGGVAGG LGQTAAYPLDVVRRRIQTTGYGDGKGVENLKHSTLKTMFTIFQKEGIYALFKGISINYIK VIPTNGVAFLTYETLCDYFNSKLNKN
Source in vitro E.coli expression system
Gene Names mcfR
Protein Names Recommended name: Mitochondrial substrate carrier family protein R Alternative name(s): Solute carrier family 25 member 16 homolog B
Expression Region 1-326
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. May be involved in the accumulation of coenzyme A in the mitochondrial matrix (By similarity).
Subcellular Location Mitochondrion inner membrane, Multi-pass membrane protein
Protein Families Mitochondrial carrier (TC 2.A.29) family
Database Links

KEGG: ddi:DDB_G0283811

STRING: 44689.DDB0234096

Related Products

mcfR Proteins

mcfR Proteins for Dictyostelium discoideum (Slime mold)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.