Recombinant Dog Prostaglandin E2 receptor EP1 subtype(PTGER1)

Code CSB-CF860618DO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9BGL8
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Canis lupus familiaris (Dog) (Canis familiaris)
Sequence MSLCGPLNLSLAGEATPCAEPGAPNASAWPPSGRASASPALPIFSMTLGAVSNVLALALL AQAAGRLRRRRSAATFLLFVASLLATDLAGHVIPGALVLRLYAAGRSPAGGACHFLGGCM VFFGLCPLLLGCGMAVERCVGVTRPLLHAARVSAARARLALAVLAALALAVALLPLARVG RYELQYPGTWCFIGLRPAGGWRQALLAGLFAGLGLAALLAALVCNTLSGLALLRARWRRR RSRRRPQACGPDGRRHWGARAPRSASASSSSSVASVPGGSPGRGSARRARAHDVEMVGQL VGIMVVSCICWSPLLVLVVLAVGGWGSSSLQRPLFLAVRLASWNQILDPWVYILLRQAVL RQLLRLLPPRPGAKGSPAGLALTRSAWEASSLRSSRHSSLSHL
Source in vitro E.coli expression system
Gene Names PTGER1
Protein Names Recommended name: Prostaglandin E2 receptor EP1 subtype Short name= PGE receptor EP1 subtype Short name= PGE2 receptor EP1 subtype Alternative name(s): Prostanoid EP1 receptor
Expression Region 1-403
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for prostaglandin E2 (PGE2). The activity of this receptor is mediated by G(q) proteins which activate a phosphatidylinositol-calcium second messenger system. May play a role as an important modulator of renal function. Implicated the smooth muscle contractile response to PGE2 in various tissues (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

STRING: 9615.ENSCAFP00000024002

Pathway Calcium signaling pathway

Related Products

PTGER1 Proteins

PTGER1 Proteins for Canis lupus familiaris (Dog) (Canis familiaris)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.