Recombinant Drosophila pseudoobscura pseudoobscura Nucleoporin Ndc1(Ndc1)

Code CSB-CF641848DME
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q298S5
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Drosophila pseudoobscura pseudoobscura (Fruit fly)
Sequence MSHLSTINACKLLLFRRCLQAVLLTVGIQFLLLTIFLLFVNFQLLRPLHWISVTLSLVCS MYTWFASIPLVGAVVLYGMILCQQHLAERLYCPTRFRWLVHYAPRKLLFLAAHLLVGYLT AWLYTGYMHTDYRHLWYKCYDQECISAYHVYLLGMGIFAGCYYFVSVHMRQEVEIEFPIV NHLWGEKLREVLYSSLARSLIKSLLPTLAYTLLFWLFGGVVCHKLSHIFAVDLDERLEGF FGVATNGRLLFYGWLLTSQILSNMHLMRCFYSMFLSEEFPLAITKNRAAFVQEKEVTVVA ALGLSNVYVVQCLAAKYLYNLVTAGDAEKRSELFQLTEPGNRPANWRSLCDQCLSLFGNF TDELIDSMQKISVLKGSPSSPPLTPISENASASLMAERVLTRQYNQMHGIRAIVSPRSNA VIDRPVDRIHRVPDWCERTSMQLEQSLQLLINRIPGIVYMFTEPEGAKTAFLLTHSLPLV FVIQALSQICVFSLKEDRYGVVQTDLPDIIRSMSRLKGELDKLSSVASNLRGPGSSFSVL RGAVRRSLFHICVAFGEYLSELIPSGEELHQLQTVINQE
Source in vitro E.coli expression system
Gene Names Ndc1
Protein Names Recommended name: Nucleoporin Ndc1
Expression Region 1-579
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Component of the nuclear pore complex (NPC), which plays a key role in de novo assembly and insertion of NPC in the nuclear envelope.
Subcellular Location Nucleus, nuclear pore complex, Nucleus membrane, Multi-pass membrane protein
Protein Families NDC1 family
Database Links

KEGG: dpo:Dpse_GA19183

STRING: 7237.FBpp0282051

Related Products

Ndc1 Proteins

Ndc1 Proteins for Drosophila pseudoobscura pseudoobscura (Fruit fly)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.