Recombinant Drosophila pseudoobscura pseudoobscura Putative inositol monophosphatase 3(GA13929)

Code CSB-CF644944DME
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q29JH0
Storage Buffer Tris-based buffer,50% glycerol
Species Drosophila pseudoobscura pseudoobscura (Fruit fly)
Sequence MSSSKMNGRSIRINRVPATIFAILLTIVLVYFLNFHQEERPAIYGKLRSDNPNRVNLRKM LIAAIQASQRGGLEVLDVARSRQLKVRSKGQTDEGVNDPFTDADGRSHCVMKQGLQRIFP RVRIFSEEDKEHCKESHSYDLDPTVLHETAQVPDVSVNAQDVTVWVDPLDATKEFTEELY EYVTTMVCVAVAGRPVIGVIHSPFNGQTAWAWVGNSMSEYLAGLHPPHGQENELPIITVS RSHTAGAKDLARGIFGEQVNLLTAAGAGYKVLQVVANNATAYLHTSKIKKWDICAGDAIL HALGGTMTTLNDQLIRYGPDESPVNTEGLLATLEKHDKYMDQLVKYRTAHNGQLA
Source in vitro E.coli expression system
Gene Names GA13929
Protein Names Recommended name: Putative inositol monophosphatase 3 Short name= IMP 3 Short name= IMPase 3 EC= 3.1.3.25 Alternative name(s): Inositol-1(or 4)-monophosphatase 3 Myo-inositol monophosphatase A3
Expression Region 1-355
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Single-pass membrane protein
Protein Families Inositol monophosphatase superfamily
Database Links

KEGG: dpo:Dpse_GA13929

STRING: 7237.FBpp0273216

Related Products

GA13929 Proteins

GA13929 Proteins for Drosophila pseudoobscura pseudoobscura (Fruit fly)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.