Recombinant ER lumen protein retaining receptor(ERD2)

Code CSB-CF527359EKM
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O44017
Storage Buffer Tris-based buffer,50% glycerol
Species Entamoeba histolytica
Sequence MVFNLFRISADLVHLLSIYFLLTKIISHKNCIGISLRSQILFFIVWVTRYLDIFYNFYSL YNTILKIVYLTTSAYTIYLISKRFRATYDKIHDTLNVWYLIVPCIVLAFIFTEDYSITEI CWTFSIFLEAVAILPQILLLRSTGEVENLNSQYIFCLGLYRALYIINWIYRYATEQSYWS PLTWICGSIQTLLYVEYFYYYIKSRVEGTKFVLPY
Source in vitro E.coli expression system
Gene Names ERD2
Protein Names Recommended name: ER lumen protein retaining receptor
Expression Region 1-215
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Required for the retention of luminal endoplasmic reticulum proteins. Determines the specificity of the luminal ER protein retention system. Also required for normal vesicular traffic through the Golgi (By similarity).
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families ERD2 family

Related Products

ERD2 Proteins

ERD2 Proteins for Entamoeba histolytica

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.