Recombinant ER lumen protein retaining receptor(erd-2)

Code CSB-CF717203CXX
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q611C8
Storage Buffer Tris-based buffer,50% glycerol
Species Caenorhabditis briggsae
Sequence MNIFRITADLAHAVAIVILLLKIWKSRSCEGISGRSQILFAVTFFTRYLDLFTSFYSLYN TVMKVLFLAGSIGTVYLMWVKFKATYDRNNDTFRIEFLVIPSIILALIINHEFMFMEVMW TFSIYLEAVAIMPQLFMLSRTGNAETITAHYLFALGSYRFLYIFNWVYRYYTESFFDPIA VVAGIVQTVLYADFFYLYITRVIQSNRQFEMSA
Source in vitro E.coli expression system
Gene Names erd-2
Protein Names Recommended name: ER lumen protein retaining receptor
Expression Region 1-213
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Required for the retention of luminal endoplasmic reticulum proteins. Determines the specificity of the luminal ER protein retention system. Also required for normal vesicular traffic through the Golgi (By similarity).
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families ERD2 family
Database Links

KEGG: cbr:CBG17162

STRING: 6238.CBG17162

Related Products

erd-2 Proteins

erd-2 Proteins for Caenorhabditis briggsae

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.