Recombinant Ehrlichia ruminantium Glycerol-3-phosphate acyltransferase(plsY)

Code CSB-CF701937EAAA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q5FF11
Storage Buffer Tris-based buffer,50% glycerol
Species Ehrlichia ruminantium (strain Gardel)
Sequence MDFQVVIFILCYFIGSIPFGFILSYVTGIGDIRKTGSGNIGATNVFRKNKKLALLTLLLD ALKSFICVAIAQKYNIDNTILFLAALFAIIGHMFPVYLFFKGGKGVAPLLGSLIFIDYKV ALCFLTFWIICFLLCKYASLSSIVSTLIALLFICTYYTIVQSVIFAITALLIITQHTDNI IRMLNKSENKINLKL
Source in vitro E.coli expression system
Gene Names plsY
Protein Names Recommended name: Glycerol-3-phosphate acyltransferase Alternative name(s): Acyl-PO4 G3P acyltransferase Acyl-phosphate--glycerol-3-phosphate acyltransferase G3P acyltransferase Short name= GPAT EC= 2.3.1.n3 Lysophosphati
Expression Region 1-195
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as fatty acyl donor, but not acyl-CoA or acyl-ACP.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families PlsY family
Database Links

KEGG: erg:ERGA_CDS_00020

Related Products

plsY Proteins

plsY Proteins for Ehrlichia ruminantium (strain Gardel)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.