Recombinant Elephantid herpesvirus 1 G-protein coupled receptor

Code CSB-CF623280EAAN
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q18LE5
Storage Buffer Tris-based buffer,50% glycerol
Species Elephantid herpesvirus 1 (isolate Asian elephant/Berlin/Kiba/1998) (EIHV-1) (Elephant endotheliotropic herpesvirus)
Sequence MDVLNLFNETIKVGAFNATQLVEAYVISIFSLTTFVGLAITLYLGIAYLYKKPADQVVGL VCCDVLIVNAVCLITLPLWVYQAATKKWFGGEFMCKFAGMFYTMNVYMSVWSCVIVTFDR WYCMMCKNLQAVTVLGRTIRTNQVVTILTLLVTFIGLFSLTETSIVDKKCYLYSGDSLLS FVNAALGYTVPWLAIAIMIVHIILRTSRLDYDPKWLNTNILMWMMFTLLVTQGPYYSLSA YMGNFKSFVEKNMTHHSNKVTASYFHGDASHSIQVAMLVCTHALAITRMFSVPLILSTLA GYEPLYVWKRITRCCCMRVEYENLEDESQSKLLRGEENPNYDYSPKSVRIKPLKSPGGGD NSSLKDEGYDEESQNGFSIG
Source in vitro E.coli expression system
Protein Names Recommended name: G-protein coupled receptor
Expression Region 1-380
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Host membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family

Related Products

Proteins

Proteins for Elephantid herpesvirus 1 (isolate Asian elephant/Berlin/Kiba/1998) (EIHV-1) (Elephant endotheliotropic herpesvirus)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.