Recombinant Emericella nidulans pH-response regulator protein palH/RIM21(palH)

Code CSB-CF868469EKF
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9P904
Storage Buffer Tris-based buffer,50% glycerol
Species Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans)
Sequence MEDDGRLAPRQIWARPTSTTTRSYVPGCTPFLLPSDGYVYLNRTYSISLGENAIYDPACT STPTTTEHAGAALDIHDPFYASVTPLLYAMGCATVVSYLLVIILLITPRTFYVGGPGGGA NFLGRHGMVSGSYSNNSSVVGVGGRPWLQKVAALLVAISLTIATADSFRVAEKQYDHGYS DAEALTSEVIDGTEIKVVRIISSTFLWLAQVQTLIRLFPRHKEKVMIKWAGFALIVLDTI FAILDKFLVKTNTTRPRLYEDAIPALSYLFELALNLLYAAWVIFYSLSKHRFAFFHPKMR NICLVALLSLCAVLIPVVFFVLDIAKPEIAGWGTYIRWVGSAAASVVVWEWVERIEALER DERKDGILGREVFDGDEMIEVTPSEEVDWPRQQFHGHDRGGGTGMSSAWGGVMGLAHRPL RPRGGRITQTQREAEGATAAKSRKRRSARPTPPPAAVTPVSRADTTSAASTVYNVHYYPV SSPTPPVAMPFMEEEDEGSDGDGEKELAVVQNQQSSLPTQDTYTEPRRQNSPQIVNVDNR WRFILNPFKNRHAALPREVASAQAEEEGFLSPDDQAPRQGDEENPHYTPRHRGLFSFHPM SDGASRRQSGADQPLPVTVIPARRRGQDTWSPQWFTNSNLVDRSSSRRTASRPRDQRMKV IQPQVQSAAPWTAADMEASFSSMDYELRYDPEAAALVSEDIPDHHSQPTQADSPAHPTMS GGNGPSGGETQSALDTGPGIEGSVNEGSVIEGPEESHSQR
Source in vitro E.coli expression system
Gene Names palH
Protein Names Recommended name: pH-response regulator protein palH/RIM21
Expression Region 1-760
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Required for the proteolytic cleavage of the transcription factor pacC in response to alkaline ambient pH. Might be a pH sensor.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families PalH/RIM21 family
Database Links

KEGG: ani:AN6886.2

STRING: 162425.CADANIAP00007687

Related Products

palH Proteins

palH Proteins for Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.