Recombinant Encephalitozoon cuniculi Uncharacterized membrane protein ECU09_1950(ECU09_1950)

Code CSB-CF854721EKH
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8STK5
Storage Buffer Tris-based buffer,50% glycerol
Species Encephalitozoon cuniculi (strain GB-M1) (Microsporidian parasite)
Sequence MDCLRKQAEKIPILDAIEKRMNIRKEYALLGISFFCLVIIMATSLGPLITSTVGIIVPLQ ETLVILRQVNPKKDEAKHMLVFWMVFGILTSLDAYSGAIISFIPLWYTMKFFFLLWAGPL KFRGGIIIYDNILARIPEKWYREEGGIEHAVKKATDAVKTVAESEFNKKDVIESSKKTD
Source in vitro E.coli expression system
Gene Names ECU09_1950
Protein Names Recommended name: Uncharacterized membrane protein ECU09_1950
Expression Region 1-179
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families DP1 family
Database Links

KEGG: ecu:ECU09_1950

STRING: 284813.XP_955749.1

Related Products

ECU09_1950 Proteins

ECU09_1950 Proteins for Encephalitozoon cuniculi (strain GB-M1) (Microsporidian parasite)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.