Code | CSB-CF395024EIZ |
Size | Pls inquire other sizes |
Source | in vitro E.coli expression system |
Target Names | Ent638_3411 |
Uniprot No. | A4WEE1 |
Species | Enterobacter sp. (strain 638) |
Expression Region | 1-165 |
Target Protein Sequence | MERFFENAMYASRWLLAPVYFGLSLALVALSIKFFQEIFHVLPNIFSVAESDLILVLLSL VDMTLVGGLLVMVMFSGYENFVSQLDIAEHKEKLSWLGKMDASSLKNKVAASIVAISSIH LLRVFMDAKNIPDNKLMWYVIIHLTFVLSAFVMGYLDKINRSGKY |
Protein Length | full length protein |
Tag Info | The following tags are available. N-terminal 10xHis-tagged The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
|
Form | Lyophilized powder |
Buffer before Lyophilization | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet | Please contact us to get it. |
Still Have Questions? | Start a Chat |
Subcellular Location | Cell membrane, Multi-pass membrane protein |
Protein Families | UPF0114 family |
Database Links |
KEGG: ent:Ent638_3411 STRING: 399742.Ent638_3411 |
Recombinant Human Extracellular superoxide dismutase [Cu-Zn](SOD3)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Meteorin-like protein(METRNL)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Keratin, type II cytoskeletal 6A(KRT6A)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Tyrosine-protein kinase transmembrane receptor ROR1(ROR1),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Diacylglycerol kinase gamma(DGKG),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Mouse Sulfotransferase 1A1(Sult1a1)
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Human Neuronal calcium sensor 1(NCS1)
Express system: E.coli
Species: Homo sapiens (Human)