Recombinant Enterobacter sp. UPF0266 membrane protein Ent638_2389 (Ent638_2389)

Code CSB-CF395004EIZ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A4WBH8
Storage Buffer Tris-based buffer,50% glycerol
Species Enterobacter sp. (strain 638)
Sequence MTVTDIVLVLFIVALLAYAFYDEFIMPRRNGETLLAVPLLRRGRVDAFIFAGLLAILIYN NVMSQGALLTTWLLCVLALMAFYLFWIRAPKIIFKSHGFFFANIWIEYNRIKEMNLSEDG VLVIQLEQRRLLVRVKNIDDLEKIYKIMVKTQ
Source in vitro E.coli expression system
Gene Names Ent638_2389
Protein Names Recommended name: UPF0266 membrane protein Ent638_2389
Expression Region 1-152
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families UPF0266 family
Database Links

KEGG: ent:Ent638_2389

STRING: 399742.Ent638_2389

Related Products

Ent638_2389 Proteins

Ent638_2389 Proteins for Enterobacter sp. (strain 638)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.