Recombinant Enterococcus faecalis UPF0316 protein EF_1609(EF_1609)

Code CSB-CF800784ELW
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q834N5
Storage Buffer Tris-based buffer,50% glycerol
Species Enterococcus faecalis (strain ATCC 700802 / V583)
Sequence MVVDLKMLAMIFIINFAYITLNTIRFMLTMKGYRVIAPLVSMAEITIYVLGLSMVLNRLD NPLNLLVYALGYAVGISVGIKIEDYLALGYIMVSVILPSTTEQFHLPETLREHGYGVTQS VAYGREGERMVLEILSPRKNERTLYKLINQLEPRAFIISYEPKFISGGFWTKKVRKRNDA ISH
Source in vitro E.coli expression system
Gene Names EF_1609
Protein Names Recommended name: UPF0316 protein EF_1609
Expression Region 1-183
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families UPF0316 family
Database Links

KEGG: efa:EF1609

STRING: 226185.EF1609

Related Products

EF_1609 Proteins

EF_1609 Proteins for Enterococcus faecalis (strain ATCC 700802 / V583)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.