Product Details

Target Names

BILF1

Uniprot No.

P03208

Alternative Names

BILF1; G-protein coupled receptor BILF1

Species

Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)

Expression Region

1-312

Target Protein Sequence

MLSTMAPGSTVGTLVANMTSVNATEDACTKSYSAFLSGMTSLLLVLLILLTLAGILFIIF VRKLVHRMDVWLIALLIELLLWVLGKMIQEFSSTGLCLLTQNMMFLGLMCSVWTHLGMAL EKTLALFSRTPKRTSHRNVCLYLMGVFCLVLLLIIILLITMGPDANLNRGPNMCREGPTK GMHTAVQGLKAGCYLLAAVLIVLLTVIIIWKLLRTKFGRKPRLICNVTFTGLICAFSWFM LSLPLLFLGEAGSLGFDCTESLVARYYPGPAACLALLLIILYAWSFSHFMDSLKNQVTVT ARYFRRVPSQST

Protein Length

full length protein

Tag Info

Tag type will be determined during the manufacturing process.

The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer before Lyophilization

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet

Please contact us to get it.

Target Background

Function

Constitutively active G protein-coupled receptor that plays a role in the modulation of host immunity. As a consequence of its constitutive activity, mediates host CXCR4 inhibition. Enhances degradation of host major histocompatibility complex class I antigens via lysosomes. Targets also newly synthesized MHC-I/peptide complexes en route to the host cell surface. Inhibits the host EIF2AK2/PKR phosphorylation.

Gene References into Functions

These data indicate that whilst BNLF2a interferes with antigen presentation with diminishing efficiency as lytic cycle progresses (IE>E>>L), interference by BILF1 increases with progression through lytic cycle (IE PMID: 25144360
BILF1 cytoplasmic C-terminal tail is required for reducing surface HLA class I expression since it is expressed early in the viral lytic cycle targeting a broad range of (HLA) class I molecules, including multiple HLA-A and -B types and HLA-E. PMID: 23315076
This study therefore extends our initial observations on BILF1 to show that this immunoevasin can target MHC-I antigen presentation via both the exocytic and endocytic trafficking pathways. PMID: 21123379
Study show the formation of hetero-oligomeric complexes between this viral BILF1 and human CXCR4. BILF1 impaired CXCL12 binding to CXCR4 and, consequently, also CXCL12-induced signaling. PMID: 20622011
Inverse agonists for BIL1 could inhibit cell transformation and be relevant therapeutic candidate. PMID: 20543866
BILF1 physically interacts with various host chemokine receptors on the cell surface of human cells. PMID: 18823943
BILF1 reduced the levels of MHC class I at the cell surface and inhibited CD8(+) T cell recognition of endogenous target antigens PMID: 19119421

Hide All

Subcellular Location

Host cell membrane; Multi-pass membrane protein.

Protein Families

Epstein-Barr virus BILF1 protein family

Database Links

KEGG: vg:3783707

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：

Code	CSB-CF360988EFA
MSDS	MSDS
Size	Pls inquire
Source	in vitro E.coli expression system
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Epstein-Barr virus Probable membrane protein (BILF1)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage