Recombinant Equine herpesvirus 1 Envelope glycoprotein G(gG)

Code CSB-CF308039EFO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P84393
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Equine herpesvirus 1 (strain V592) (EHV-1) (Equine abortion virus)
Sequence RLAPDELCYAEPRRTGSPPNTQPERPPVIFEPPTIAIKAESKGCELILLDPPIDVSYRRE DKVNASIAWFFDFGACRMPIAYREYYGCIGNAVPSPETCDAYSFTLIRTEGIVEFTIVNM SLLFQPGIYDSGNFIYSVLLDYHIFTGRVTLEVEKDTNYPCGMIHGLTAYGNINVDETMD NASPHPRAVGCFPEPIDNEAWANVTFTELGIPDPNSFLDDEGDYPNISDCHSWESYTYPN TLRQATGPQTLLVGAVGLRILAQAWKFVGDETYDTIRAEAKNLETHVPSSAAESSLENQS TQEESNSPEVAHLRSVNSDDSTHTGGASNGIQDCDSQLKTVYACLALIGLGTCAMIGLIV YICVLRSKLSSRNFSRAQNVKHRNYQRLEYVA
Source in vitro E.coli expression system
Gene Names gG
Protein Names Recommended name: Envelope glycoprotein G Short name= gG
Expression Region 20-411
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Chemokine-binding protein that inhibits neutrophils' chemotaxis.
Subcellular Location Virion membrane, Single-pass type I membrane protein
Protein Families Alphaherpesvirinae glycoprotein G family
Database Links

KEGG: vg:2948582

Related Products

gG Proteins

gG Proteins for Equine herpesvirus 1 (strain V592) (EHV-1) (Equine abortion virus)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.