Recombinant Equine herpesvirus 2 Uncharacterized gene E9 protein(E9)

Code CSB-CF720980EFP
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q66676
Storage Buffer Tris-based buffer,50% glycerol
Species Equine herpesvirus 2 (strain 86/87) (EHV-2)
Sequence SSTTSTTATSNGTTSTLNTTVSSVASTSTPSTESTTTTTPTTTNSSASSTSVTVASTATT SPQTNSTTSLTSPLSSTFSSTSANVSSSTTTTTSSTTKSTSSTKPKTSKNNPKTQEAGAE AAVMISLGILYLFILLLIIFVIILICFIRRRQHHQHGGGGGGQGGPMIPLDVISLESGLG ESWSSE
Source in vitro E.coli expression system
Gene Names E9
Protein Names Recommended name: Uncharacterized gene E9 protein
Expression Region 20-205
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Host membrane, Single-pass membrane protein
Database Links

KEGG: vg:1461014

Related Products

E9 Proteins

E9 Proteins for Equine herpesvirus 2 (strain 86/87) (EHV-2)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.