Recombinant Erwinia carotovora subsp. atroseptica UPF0208 membrane protein ECA3038(ECA3038)

Code CSB-CF738452EAAB
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q6D2Q7
Storage Buffer Tris-based buffer,50% glycerol
Species Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) (Erwinia carotovora subsp. atroseptica)
Sequence MATKPDSRISWLQLLQRGQHYMKTWPAEKQLAPLFPENRVARATRFGIRIMPPLAVFTLT WQIALGGQLGPAIATALFACSLPLQGLWWLGRRSVTPLPPTLAQWFHEIRHKLLESGQAL APLEEAPTYQTLADVLKRAFNQLDKTFLDDL
Source in vitro E.coli expression system
Gene Names ECA3038
Protein Names Recommended name: UPF0208 membrane protein ECA3038
Expression Region 1-151
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families UPF0208 family
Database Links

KEGG: eca:ECA3038

STRING: 218491.ECA3038

Related Products

ECA3038 Proteins

ECA3038 Proteins for Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) (Erwinia carotovora subsp. atroseptica)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.