Recombinant Exiguobacterium sibiricum UPF0316 protein Exig_2248 (Exig_2248)

Code CSB-CF452115EPT
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. B1YKE7
Storage Buffer Tris-based buffer,50% glycerol
Species Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15)
Sequence MGQILLILLLQLIYVPVLTLRTIMLVKGRTIIAGVLGTVETLIYIFALGIVFRDLTTVGM IVYALGFGLGILIGGFVERKLAIGYNMIQVHTQDFPAELIQVIRDNGFGVTHYQGQGRDG IRYRLDVLAARTRMKVLRNLVEEYEPKAFLVAFDSVDFKGGYMLKGLKRSQ
Source in vitro E.coli expression system
Gene Names Exig_2248
Protein Names Recommended name: UPF0316 protein Exig_2248
Expression Region 1-171
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families UPF0316 family
Database Links

KEGG: esi:Exig_2248

STRING: 262543.Exig_2248

Related Products

Exig_2248 Proteins

Exig_2248 Proteins for Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.