Recombinant Exiguobacterium sp. UPF0316 protein EAT1b_0871 (EAT1b_0871)

Code CSB-CF504742EPU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. C4L5I5
Storage Buffer Tris-based buffer,50% glycerol
Species Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
Sequence MGQILLILLLQLIYVPVLTLRTIMLVKGKTVIAGLFGTLETLIYIFALGIVFQDLTTVGM IVYAVGFGLGILLGGFVERKLAIGYNMIQVHTKEYPAELIQQMRDNGYGVTHYQGQGRDG VRYRLDVLAARTRMKELRELVEKHEPKAFLVAFDPIDFKGGYMMKGLRRPK
Source in vitro E.coli expression system
Gene Names EAT1b_0871
Protein Names Recommended name: UPF0316 protein EAT1b_0871
Expression Region 1-171
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families UPF0316 family
Database Links

KEGG: eat:EAT1b_0871

STRING: 360911.EAT1b_0871

Related Products

EAT1b_0871 Proteins

EAT1b_0871 Proteins for Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.