Recombinant Francisella tularensis subsp. tularensis Lipoprotein signal peptidase(lspA)

Code CSB-CF689710FAAA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q5NGD1
Storage Buffer Tris-based buffer,50% glycerol
Species Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Sequence MNLLRPKLKYFILAILIIAADLYTKYLANTYLEFAQSLKITSFFNLTLLYNHGAAFSLLS NDQTSWQMIMFSTISLIAAIVLIYLIIKQPITEKINLFSFALILGGALGNFYDRAFQGYV IDFLDFHIGNYHWPSFNIADSAITCGVVILIAASLFTKKKS
Source in vitro E.coli expression system
Gene Names lspA
Protein Names Recommended name: Lipoprotein signal peptidase EC= 3.4.23.36 Alternative name(s): Prolipoprotein signal peptidase Signal peptidase II Short name= SPase II
Expression Region 1-161
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families Peptidase A8 family
Database Links

KEGG: ftu:FTT_0914c

STRING: 177416.FTT_0914c

Related Products

lspA Proteins

lspA Proteins for Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.