Recombinant GDP-mannose-dependent alpha-(1-2)-phosphatidylinositol mannosyltransferase

Code CSB-CF519138MVZ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O06204
Storage Buffer Tris-based buffer,50% glycerol
Sequence MRIGMICPYSFDVPGGVQSHVLQLAEVMRTRGHLVSVLAPASPHAALPDYFVSGGRAVPI PYNGSVARLRFGPATHRKVKKWLAHGDFDVLHLHEPNAPSLSMLALNIAEGPIVATFHTS TTKSLTLTVFQGILRPMHEKIVGRIAVSDLARRWQMEALGSDAVEIPNGVDVDSFASAAR LDGYPRQGKTVLFLGRYDEPRKGMAVLLDALPKVVQRFPDVQLLIVGHGDADQLRGQAGR LAAHLRFLGQVDDAGKASAMRSADVYCAPNTGGESFGIVLVEAMAAGTAVVASDLDAFRR VLRDGEVGHLVPVDPPDLQAAALADGLIAVLENDVLRERYVAAGNAAVRRYDWSVVASQI MRVYETVAGSGAKVQVAS
Source in vitro E.coli expression system
Protein Names Recommended name: GDP-mannose-dependent alpha-(1-2)-phosphatidylinositol mannosyltransferase EC= 2.4.1.57 Alternative name(s): Alpha-mannosyltransferase Guanosine diphosphomannose-phosphatidyl-inositol alpha-mannosyltransferase Phos
Expression Region 1-378
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat

Related Products

Proteins

Proteins for

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.