Recombinant Gadus morhua Melanopsin-B(opn4b)

Code CSB-CF800291GER
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q804Q2
Storage Buffer Tris-based buffer,50% glycerol
Species Gadus morhua (Atlantic cod)
Sequence MDMDRGFYRKVDVPDHAHYVIAFFVLIIGVVGVTGNALVMYAFLCNKKLRTPPNYFIMNL AVSDFLMAITQSPIFFINSLFKEWIFGETGCRMYAFCGALFGITSMINLLAISLDRYIVI TKPPQAIRWVSGRRTMVVILLVWLYSLAWSLAPLLGWSSYIPEGLMTSCTWDYVTSTPAN KGYTLMLCCFVFFIPLGIISYCYLCMFLAIRSAGREIERLGTQVRKSTLMQQQTIKTEWK LTKVAFVVIIVYVHSWSPYACVTLIAWAGYGSHLSPYSKAVPAVIAKASAIYNPFIYAII HSKYRDTLAEHVPCLYFLRQPPRKVSMSRAQSECSFRDSMVSRQSSASKTKFHRVSSTST ADTQVWSDVELDPMNHEGQSLRTSHSLGVLGRSKEHRGPPAQQNRQTRSSDTLEQATVAD WRPPLTALRCDRNFLPQPTHPPYKMAAATPLQATTVDNVTPEHWNKHPNNNHKNHNNRHN GNNNNEEHEYSGKGGRHCQNHPHHIDVKNSISNCKKTCEKDTFSKEPVPCNAADDVRFSP RSAHTIQHAMGTPFRYMPEGDIACQERLSTDRSQRGDPLPDSKSLNCTGDVPVSAQRCSF PHETSRNLEESFMAL
Source in vitro E.coli expression system
Gene Names opn4b
Protein Names Recommended name: Melanopsin-B Alternative name(s): Opsin-4B
Expression Region 1-615
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Photoreceptor implicated in non-image-forming responses to light.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family, Opsin subfamily
Tissue Specificity Expressed in the inner nuclear layer of the retina, possibly in amacrine and ganglion cells. Expressed in a subpopulation of neurons in the dorsal habenula.

Related Products

opn4b Proteins

opn4b Proteins for Gadus morhua (Atlantic cod)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.