Recombinant General secretion pathway protein B(exeB)

Code CSB-CF332704AXW
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P45755
Storage Buffer Tris-based buffer,50% glycerol
Species Aeromonas hydrophila
Sequence MSTLLKALRRAEQPQFTPHIPAMGLPVTQEEEQNRRWIWWLLAPLALLMGAGANYGWHLL NNRPIEKTVEVKEVVTPPFVRVEPRPMITRPLPPPLPEPVVRPRVTPNDSAPAANGSQGL AERIMNALNSTPLMEETAPQAQSESQAMPISALPLELKQRVPPLAYGSHVFSSNPAKRAV MLNGREFREGSEVAPGVTLIAIAQDYIILQVAGQNVSLKALQDWRG
Source in vitro E.coli expression system
Gene Names exeB
Protein Names Recommended name: General secretion pathway protein B
Expression Region 1-226
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in a general secretion pathway (GSP) for the export of proteins.
Subcellular Location Cell inner membrane, Single-pass membrane protein
Protein Families ExeB/OutB/PulB family

Related Products

exeB Proteins

exeB Proteins for Aeromonas hydrophila

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.