Recombinant Geobacillus thermodenitrificans UPF0754 membrane protein GTNG_0550 (GTNG_0550)

Code CSB-CF392930GEH
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A4IKS8
Storage Buffer Tris-based buffer,50% glycerol
Species Geobacillus thermodenitrificans (strain NG80-2)
Sequence MNTFVYLLFMMAVGALIGGMTNFIAIVMLFRPYEPIYIFGKRLPLTPGLIPKRRRELAEQ LGKTVVEHLVTPEGLRRKLTDPVFVAEVADWGREWLKRWLSRRETPAQLLERLGVHAPDE WLSELAAKQAGRAYEQWSETWRLRPIRDLLSPELKETMESRIESLADYLADRVIDYFSSE EGKRQIAGMIDRFFQERGMVGGMMQMLLGNVNFVDKVQSELGKFLRHAGTRAMLARLLWT EWNKWISYPLAAVEEMIGRQRIKETVSAAARGLVRNNDWLDRPLAELIAPYERELFDRFV PQAANAAIHALSDKIEGIVGKLGLADIVRNQVESFSLRRLEVIILSIARRELKMITYLGA LLGAMIGAVQGIIGLWL
Source in vitro E.coli expression system
Gene Names GTNG_0550
Protein Names Recommended name: UPF0754 membrane protein GTNG_0550
Expression Region 1-377
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families UPF0754 family
Database Links

KEGG: gtn:GTNG_0550

STRING: 420246.GTNG_0550

Related Products

GTNG_0550 Proteins

GTNG_0550 Proteins for Geobacillus thermodenitrificans (strain NG80-2)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.