Recombinant Gloeobacter violaceus Prolipoprotein diacylglyceryl transferase(lgt)

Code CSB-CF755773GCI
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q7ND43
Storage Buffer Tris-based buffer,50% glycerol
Species Gloeobacter violaceus (strain PCC 7421)
Sequence MPMETGFTSPGPLIVQIGGFAVRWYSLLILAGIIAGTLLSQKLAPERKVAPEVLSDLVVW LVVGAIPMARLYYVLFEWQRFAGEPWWKVFAIWEGGIAIHGAILGGLLAGWLFCRRNGYS LLTMIDLAAPGLILGQAIGRWGNFFNSEAYGAPTNLPWKLFIPEANRPPGMAAFAYYHPT FLYESLWNLGVLALLLFVFFRFKNLRPGSIACLYALAYSVGRFWIEGLRLDSLMVGPLRT AQLVSLAGIVLGAVGLWWLNRRSARQEAP
Source in vitro E.coli expression system
Gene Names lgt
Protein Names Recommended name: Prolipoprotein diacylglyceryl transferase EC= 2.4.99.-
Expression Region 1-269
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Transfers the N-acyl diglyceride group on what will become the N-terminal cysteine of membrane lipoproteins.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families Lgt family
Database Links

KEGG: gvi:gll4393

STRING: 251221.gll4393

Related Products

lgt Proteins

lgt Proteins for Gloeobacter violaceus (strain PCC 7421)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.