Recombinant Gorilla gorilla gorilla Vomeronasal type-1 receptor 1(VN1R1)

Code CSB-CF823862GGZ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8WN92
Storage Buffer Tris-based buffer,50% glycerol
Species Gorilla gorilla gorilla (Western lowland gorilla)
Sequence MVGDTLKLLSPLMTRYFFLLFYSTDSSDLNENQHPLDFDEMAFGKVKSGISFLIQTGVGI LGNSFLLCFYNLILFTGHKLRPTDLILSHLALANSMVLFFKGIPQTMAAFGLKYLLNDTG CKFVFYYHRVGTRVSLSTICLLNGFQAIKLNPSICRWMEIKIRSPRFIDFCCLLCWVPHV LMNASVLLLVNGPLNSKNSSAKNNYGYCSYKASKRFSSLHAVLYFSPDFMSLGFMVWASG SMVFFLYRHKQQVQHNHSNRLSCRPSQETRATRTIMVLVSSFFVFYSVHSFLTIWTTVVA NPGQWIVNNSVLVASYFPSRSPFVLIMSDTRISQFCFACRTRKTLFPNLVVMP
Source in vitro E.coli expression system
Gene Names VN1R1
Protein Names Recommended name: Vomeronasal type-1 receptor 1 Alternative name(s): V1r-like receptor 1
Expression Region 1-353
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Putative pheromone receptor.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

STRING: 9593.ENSGGOP00000022152

Related Products

VN1R1 Proteins

VN1R1 Proteins for Gorilla gorilla gorilla (Western lowland gorilla)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.