Recombinant Haemophilus ducreyi Na(+)-translocating NADH-quinone reductase subunit C(nqrC)

Code CSB-CF749635HSY
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q7VNU7
Storage Buffer Tris-based buffer,50% glycerol
Species Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Sequence MAKFNKDSVSGTLTVVVLLSLICSLIVASAAVLLKPTQDIQKQLDKQKNILQAAGLMHEN TNVQETYAKFIEPKIVDLATGDYVEDVANFDAKAFAKDPATSVAIKPEDDKANIRMRAKY AEVYLVKDEMGQTTQVVLPMYGNGLWSMMYGFVAVQPDANTVNGITYYEQGETAGLGGEI ANPNWQKSFVGKKLFNANNEVALTIGKGASADKEHGVDGLSGATLTSKGVDNSFKYWFGT NGFGPYLAKFKATAGAN
Source in vitro E.coli expression system
Gene Names nqrC
Protein Names Recommended name: Na(+)-translocating NADH-quinone reductase subunit C Short name= Na(+)-NQR subunit C Short name= Na(+)-translocating NQR subunit C EC= 1.6.5.- Alternative name(s): NQR complex subunit C NQR-1 subunit C
Expression Region 1-257
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol by two successive reactions, coupled with the transport of Na(+) ions from the cytoplasm to the periplasm. NqrA to NqrE are probably involved in the second step, the conversion of ubisemiquinone to ubiquinol.
Subcellular Location Cell inner membrane, Single-pass membrane protein
Protein Families NqrC family
Database Links

KEGG: hdu:HD_0381

STRING: 233412.HD0381

Related Products

nqrC Proteins

nqrC Proteins for Haemophilus ducreyi (strain 35000HP / ATCC 700724)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.