Recombinant Haemophilus influenzae Putative permease perM homolog(perM)

Code CSB-CF337596HTA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P43969
Storage Buffer Tris-based buffer,50% glycerol
Species Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Sequence MLEMLKSWYSRRLSDPQAMGLLAILLFGFISIYFFGDLIAPLLIALVLSYLLEIPINFLN QYLKCPRMLATILIFGSFIGLAAVFFLVLVPMLWNQTISLLSDLPAMFNKSNEWLLNLPK NYPELIDYSMVDSIFNSVREKILGFGESAVKLSLASIMNLVSLGIYAFLVPLMMFFMLKD KSELLQGVSRFLPKNRNLAFXRWKEMQQQISNYIHGKLLEILIVTLITYIIFLIFGLNYP LLLAFAVGLSVLVPYIGAVIVTIPVALVALFQFGISPTFWYIIIAFAVSQLLDGNLLVPY LFSEAVNLHPLIIIISVLIFGGLWGFWGVFFAIPLATLVKAVINALPQD
Source in vitro E.coli expression system
Gene Names perM
Protein Names Recommended name: Putative permease perM homolog
Expression Region 1-349
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Autoinducer-2 exporter (AI-2E) (TC 2.A.86) family

Related Products

perM Proteins

perM Proteins for Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.