Recombinant Haemophilus influenzae Ribose transport system permease protein rbsC(rbsC)

Code CSB-CF332349HTA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P44736
Storage Buffer Tris-based buffer,50% glycerol
Species Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Sequence MMKNETSNFQIGRFLIEQRSFIALIILIAIVSMINPDFFSVDNILNILRQTSVNAIIAVG MTFVILIAGIDLSVGSVLALTGAIAASMVSIELPIFLVIPVVLLIGTLLGGISGVIVAKG KVQAFIATLVTMTLLRGITMVYTDGRPITTGFSDNADLFASIGTGYVLGIPVPIWIMSIV FAVAWYILKDTPIGRYIYALGGNEAATQLSGINVNKIKVFVFAVSGFLSALAGLIVTSRL SSAQPTAGVSYELDAIAAVVVGGTSLMGGKGRVMGTLIGALIIGFLNNALNLLDISSYYQ MIAKALVILVAVLADNYLGTKKL
Source in vitro E.coli expression system
Gene Names rbsC
Protein Names Recommended name: Ribose transport system permease protein rbsC
Expression Region 1-323
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Part of the ABC transporter complex RbsABC involved in ribose import. Probably responsible for the translocation of the substrate across the membrane.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families Binding-protein-dependent transport system permease family, AraH/RbsC subfamily
Database Links

KEGG: hin:HI0503

STRING: 71421.HI0503

Related Products

rbsC Proteins

rbsC Proteins for Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.