Recombinant Haemophilus somnus Lipid A export ATP-binding/permease protein MsbA(msbA)

Code CSB-CF605124HAAD
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q0I4C5
Storage Buffer Tris-based buffer,50% glycerol
Species Haemophilus somnus (strain 129Pt) (Histophilus somni)
Sequence MQDKDLSTLQTFKRLWPTIAPFKLGLIASAVALVFNALADAALIQMLKPVLDEGFGKVDN SLLRIMAIVVVLLIFVRGVTNFISTYCLAWVSGKVVMVMRRRLFRHLMYMPVTFFDQNSV GRLLSRIVYDSEQVANSSSGSLVTIVREGAYIIALLTVMFYTSWQLALVLFIIGPIIAVI IRIVSKKFRELGKNLQNSMGDLTSSVEQMLKGHKVVLAFGGQKIEEERFDQVSNNMRRRG MKVMAASAISDPVVQIIASFALAAVLFLATLPEIMTQNLSAGSFTVVFSSMLAMMRPLKS LTNVNAQFQRGMAACQTLFALLDLETEKDTGKHVVDTVKGEVRFENVTFSYSGKEHPALN NISFTIPQGKTVALVGRSGSGKSTIANLVTRFYDVEQGKITLDGVNIQDYTLANLREHCA VVSQQVHLFNDTIANNIAYAVTEKCTREQIIEAAEAAYAMEFIEKLENGLDTVIGENGAS LSGGQRQRLAIARALLRDSPVLILDEATSALDTESERAIQAALETLQKDRTVLVIAHRLS TIEKADEILVIEQGEIKERGSHQELLALNGAYKQLHSTQFNH
Source in vitro E.coli expression system
Gene Names msbA
Protein Names Recommended name: Lipid A export ATP-binding/permease protein MsbA EC= 3.6.3.-
Expression Region 1-582
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in lipid A export and possibly also in glycerophospholipid export and for biogenesis of the outer membrane. Transmembrane domains (TMD) form a pore in the inner membrane and the ATP-binding domain (NBD) is responsible for energy generation.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Database Links

KEGG: hso:HS_1021

STRING: 205914.HS_1021

Related Products

msbA Proteins

msbA Proteins for Haemophilus somnus (strain 129Pt) (Histophilus somni)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.