Recombinant Hahella chejuensis Electron transport complex protein RnfD(rnfD)

Code CSB-CF647095HAAI
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q2SKU7
Storage Buffer Tris-based buffer,50% glycerol
Species Hahella chejuensis (strain KCTC 2396)
Sequence MAFLRITSPHLKGPARTTAIMQWVILATVPGLLTMTWFFGWGTLINVVLASLTAVAAEAF VLTLRKRPLAFYLRDYSAVLTGVLLGLALPPYAPWWVTFVGTAFAIIFAKQIYGGLGNNP FNPAMVGYALLLVSFPVAMTTNWATPRPLAEIPGFLEAFARIFWNADIGVDGYTMATPLD TYKHEIVAGTAETVFALPVFGARTALGWEWVNLAFLAGGLLLIWRKIITWHIPVSMLAAL ALCSLLLGWDEDKYAPLQLHLLAGATMLGAFFIATDPVSAATSKLGKLYYGAGVGILTYL IRTWGNYPDAVAFAVLLMNFAAPFLDYYTQPRTYGHRKARRGVKQD
Source in vitro E.coli expression system
Gene Names rnfD
Protein Names Recommended name: Electron transport complex protein RnfD
Expression Region 1-346
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Part of a membrane complex involved in electron transport.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families NqrB/RnfD family
Database Links

KEGG: hch:HCH_01891

STRING: 349521.HCH_01891

Related Products

rnfD Proteins

rnfD Proteins for Hahella chejuensis (strain KCTC 2396)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.