Recombinant Heliobacterium modesticaldum UPF0059 membrane protein Helmi_08630 (Helmi_08630)

Code CSB-CF534961HVD
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. B0TI68
Storage Buffer Tris-based buffer,50% glycerol
Species Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
Sequence MTYWTLGVLAVGLGADAFSMALGIGMEGVRRRDAFMLGLVVALFHIFMPWFGILAGSALG LVVGRLASFIGAAVLFFLGGRMIYHAWKEKREGPAFPVSVPRRRGNGSGGGAIVGAGAIV GGRLFAPTRWELVVIGAAVSMDALSVGFSLGTVGAQLLPTVLTFGVVAGIMTVAGCRIGQ QVSRMLGATAQLAGGLILLGIGIKLLLGSASPG
Source in vitro E.coli expression system
Gene Names mntP
Protein Names Recommended name: UPF0059 membrane protein Helmi_08630
Expression Region 1-213
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Probably functions as a manganese efflux pump.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families MntP (TC 9.B.29) family
Database Links

KEGG: hmo:HM1_1086

STRING: 498761.HM1_1086

Related Products

mntP Proteins

mntP Proteins for Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.