Recombinant Heliothis virescens ascovirus 3e Uncharacterized protein ORF58 (ORF58)

Code CSB-CF391368HSI
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A4KXB3
Storage Buffer Tris-based buffer,50% glycerol
Species Heliothis virescens ascovirus 3e (HvAV-3e)
Sequence MSLTERIGQTPKAYELANERGPFSVEVYLNPGTSNTYQYVATTRNKFNNTDYDDLPWNYT SGKKVVTATGVVSGGERYVFLLRSEIAQDIQVTMYNTNGGSNPLNNSNVTRSNVDSSSYY QQPPQVVYNNGDLYGSRTGYSGAELGASIDKGIASLWGYLKQPLVMVGIAAVVGYLIYRY YYMSRPIGFGSSGAYDVPLLDTPLLRDSYRLPQSFTRDPLFRNSV
Source in vitro E.coli expression system
Gene Names ORF58
Protein Names Recommended name: Uncharacterized protein ORF58
Expression Region 1-225
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Single-pass membrane protein
Protein Families Ascovirus HvAv ORF58 family
Database Links

KEGG: vg:5076059

Related Products

ORF58 Proteins

ORF58 Proteins for Heliothis virescens ascovirus 3e (HvAV-3e)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.