Recombinant Hepatitis C virus Genome polyprotein

Code CSB-CF328762HEZ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P27961
Storage Buffer Tris-based buffer,50% glycerol
Species Hepatitis C virus (isolate HC-J7) (HCV)
Sequence STQVTGGQAAHTVRGVASIFSPGSRQDISLINTNGSWHINRTALNCNDSLQTGFFAALFY VRRFNSSGCPERLSSCRKLDDFRIGWGTLEYETNVTNEEDMRPYCWHYPPKPCGIVSAKT VCGPVYCFTPSPVVVGTTDRQGVPTYSWGENETDVFLLNSTRPPRGAWFGCTWMNGTGFT KTCGAPPCRIRRDYNGTLDLLCPTDCFRKHPDTTYLKCGAGPWLTPRCLVDYPYRLWHYP CTVNFTIFKVRMYVGGVEHRLDAACNFTRGDRCRLEDRDRSQQSPLLHSTTEWAVLPCSY SDLPALSTGLLHLHQNIVDVQYLYGLSPAITRHIVKWEWVILLFLLLADARVCA
Source in vitro E.coli expression system
Protein Names Recommended name: Genome polyprotein Cleaved into the following 4 chains: 1. Core protein p21 Alternative name(s): Capsid protein C p21 Core protein p19 Envelope glycoprotein E1 Alternative name(s): gp32 gp35 Envelope g
Expression Region 384-737
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Core protein packages viral RNA to form a viral nucleocapsid, and promotes virion budding. Modulates viral translation initiation by interacting with HCV IRES and 40S ribosomal subunit. Also regulates many host cellular functions such as signaling pathways and apoptosis. Prevents the establishment of cellular antiviral state by blocking the interferon-alpha/beta (IFN-alpha/beta) and IFN-gamma signaling pathways and by inducing human STAT1 degradation. Thought to play a role in virus-mediated cell transformation leading to hepatocellular carcinomas. Interacts with, and activates STAT3 leading to cellular transformation. May repress the promoter of p53, and sequester CREB3 and SP110 isoform 3/Sp110b in the cytoplasm. Also represses cell cycle negative regulating factor CDKN1A, thereby interrupting an important check point of normal cell cycle regulation. Targets transcription factors involved in the regulation of inflammatory responses and in the immune response
Subcellular Location Core protein p21: Host endoplasmic reticulum membrane, Single-pass membrane protein, Host mitochondrion membrane, Single-pass type I membrane protein, Host lipid droplet, Note=The C-terminal transmembrane domain of core protein p21 contains an ER signal leading the nascent polyprotein to the ER membrane, Only a minor proportion of core protein is present in the nucleus and an unknown proportion is secreted (By similarity), SUBCELLULAR LOCATION: Core protein p19: Virion, Host cytoplasm, Host nucleus, Secreted, SUBCELLULAR LOCATION: Envelope glycoprotein E1: Virion membrane, Single-pass type I membrane protein, Host endoplasmic reticulum membrane, Single-pass type I membrane protein, Note=The C-terminal transmembrane domain acts as a signal sequence and forms a hairpin structure before cleavage by host signal peptidase, After cleavage, the membrane sequence is retained at the C-terminus of the protein, serving as ER membrane anchor, A reorientation of the second hydrophobic stretch occurs after cleavage producing a single reoriented transmembrane domain, These events explain the final topology of the protein, ER retention of E1 is leaky and, in overexpression conditions, only a small fraction reaches the plasma membrane (By similarity), SUBCELLULAR LOCATION: Envelope glycoprotein E2: Virion membrane, Single-pass type I membrane protein, Host endoplasmic reticulum membrane, Single-pass type I membrane protein
Protein Families Hepacivirus polyprotein family

Related Products

Proteins

Proteins for Hepatitis C virus (isolate HC-J7) (HCV)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.