Recombinant Human Bone marrow proteoglycan(PRG2),partial

Code CSB-CF018670HU
Product Type Transmembrane Protein
Size US$1235
Uniprot No. P13727
Relevance Cytotoxin and helminthotoxin. Also induces non-cytolytic histamine release from human basophils. Involved in antiparasitic defense mechanisms and immune hypersensitivity reactions. The proform acts as a proteinase inhibitor, reducing the activity of PAPPA.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence TCRYLLVRSLQTFSQAWFTCRRCYRGNLVSIHNFNINYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWVDGSRWNFAYWAAHQPWSRGGHCVALCTRGGHWRRAHCLRRLPFICSY
Research Area Immunology
Source in vitro E.coli expression system
Gene Names PRG2
Protein Names Proteoglycan 2 Cleaved into the following chain: Eosinophil granule major basic protein Short name: EMBP
Expression Region 106-222aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 17.8kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Cytotoxin and helminthotoxin. Also induces non-cytolytic histamine release from human basophils. Involved in antiparasitic defense mechanisms and immune hypersensitivity reactions. The proform acts as a proteinase inhibitor, reducing the activity of PAPPA.
Subcellular Location Bone marrow proteoglycan: Secreted, Note=The proform is secreted, SUBCELLULAR LOCATION: Eosinophil granule major basic protein: Cytoplasmic vesicle, secretory vesicle
Tissue Specificity High levels of the proform in placenta and pregnancy serum; in placenta, localized to X cells of septa and anchoring villi. Lower levels in a variety of other tissues including kidney, myometrium, endometrium, ovaries, breast, prostate, bone marrow and co
Database Links

HGNC: 9362

OMIM: 605601

KEGG: hsa:5553

STRING: 9606.ENSP00000312134

UniGene: Hs.512633

Related Products

PRG2 Antibodies

PRG2 Antibodies for Homo sapiens (Human)

PRG2 Antibodies for Human

PRG2 Proteins

PRG2 Proteins for Homo sapiens (Human)

PRG2 ELISA Kit

PRG2 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.