Recombinant Human HLA class II histocompatibility antigen, DRB1-16 beta chain(HLA-DRB1)

Code CSB-CF640921HU
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names HLA-DRB1
Uniprot No. Q29974
Species Homo sapiens (Human)
Expression Region 30-266
Target Protein Sequence GDTRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEYRAVTELGRPDAEY WNSQKDFLEDRRAAVDTYCRHNYGVGESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVS GFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSV TSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS
Protein Length Full Length of Mature Protein
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Target Background

Function
(From Uniprot)
Binds peptides derived from antigens that access the endocytic route of antigen presenting cells (APC) and presents them on the cell surface for recognition by the CD4 T-cells. The peptide binding cleft accommodates peptides of 10-30 residues. The peptides presented by MHC class II molecules are generated mostly by degradation of proteins that access the endocytic route, where they are processed by lysosomal proteases and other hydrolases. Exogenous antigens that have been endocytosed by the APC are thus readily available for presentation via MHC II molecules, and for this reason this antigen presentation pathway is usually referred to as exogenous. As membrane proteins on their way to degradation in lysosomes as part of their normal turn-over are also contained in the endosomal/lysosomal compartments, exogenous antigens must compete with those derived from endogenous components. Autophagy is also a source of endogenous peptides, autophagosomes constitutively fuse with MHC class II loading compartments. In addition to APCs, other cells of the gastrointestinal tract, such as epithelial cells, express MHC class II molecules and CD74 and act as APCs, which is an unusual trait of the GI tract. To produce a MHC class II molecule that presents an antigen, three MHC class II molecules (heterodimers of an alpha and a beta chain) associate with a CD74 trimer in the ER to form a heterononamer. Soon after the entry of this complex into the endosomal/lysosomal system where antigen processing occurs, CD74 undergoes a sequential degradation by various proteases, including CTSS and CTSL, leaving a small fragment termed CLIP (class-II-associated invariant chain peptide). The removal of CLIP is facilitated by HLA-DM via direct binding to the alpha-beta-CLIP complex so that CLIP is released. HLA-DM stabilizes MHC class II molecules until primary high affinity antigenic peptides are bound. The MHC II molecule bound to a peptide is then transported to the cell membrane surface. In B-cells, the interaction between HLA-DM and MHC class II molecules is regulated by HLA-DO. Primary dendritic cells (DCs) also to express HLA-DO. Lysosomal microenvironment has been implicated in the regulation of antigen loading into MHC II molecules, increased acidification produces increased proteolysis and efficient peptide loading.
Gene References into Functions
  1. Single nucleotide polymorphism rs9267649 is associated with increased DNA methylation at the HLA-DRB1 differentially methylated region (DMR) and reduced expression of HLA-DRB1, suggesting a modulation of the DRB1*15:01 effect. PMID: 29921915
  2. This study has identified female sex and the HLA-DRB1*15 allele as potentially useful markers that could be used to screen donors before entry into D immunization programs. PMID: 29582441
  3. significant association between alopecia areata and HLA-DRB1*11 frequencies in Iranian cohort PMID: 29979892
  4. The univariate analysis performed revealed significant association of the HLA-DRB1*03 and HLA-DQB1*05 alleles to the infected persons (study group), while HLA-DRB1*01 was shown to be protective against HBV infection in Romania PMID: 29979894
  5. DRB1*04 and DRB1*10 alleles were significantly associated with rheumatoid arthritis patients while DRB1*15 was found more frequently in the control group. PMID: 29624881
  6. Human leukocyte antigen-DRB1*1101 is significantly associated with plaque-type psoriasis. Human leukocyte antigen-DRB1*0102 is significantly associated with other types of psoriasis rather than plaque-type psoriasis PMID: 30251731
  7. these results demonstrated that DRB1*01 may be a protective allele against atherosclerosis in individuals who live in southwest of Iran PMID: 30246695
  8. this study demonstrated that the presence of HLA-DRB1*15 was a strong factor that predisposed patients to the development of systemic lupus erythematosus and lupus nephritis, but did not influence kidney graft survival PMID: 29421495
  9. persistent down-regulation of HLA-DR expression is associated with Multidrug-resistant bacterial infection in patients with severe acute pancreatitis. PMID: 30074211
  10. This study showed for the first time that HLA-DRB1 genotypes is genetic markers associated with disability progression in Slovak MS patients. PMID: 29619906
  11. DRB1*08:03 and DRB1*11:01 are associated immune-mediated necrotizing myopathy in Japanese patients PMID: 27581220
  12. There was a significant association between HLA-DRB1*14 and (HLA-DQB1*05) and pemphigus vulgaris in Indian patients. PMID: 29582787
  13. The HLA-DRbeta1*07 allele is associated with risk of systemic lupus erythematosus whereas a protective association of HLA-DRbeta1*14 alleles with SLE was observed. PMID: 29439646
  14. This study concluded that the presence of HLA-DRB1*03 in a Portuguese population was an accurate marker of favorable disease course in patients with sarcoidosis, with no additional influence exerted by the susceptibility SNPs of BTNL2 and ANXA11 genes. PMID: 27662826
  15. THE PRESENT META-ANALYSIS SUGGESTED THAT HLA-DRB1*04 AND HLA-DRG1*16 POLYMORPHISMS MIGHT BE ASSOCIATED WITH INCREASED ALOPECIA AREATA DISEASE RISK, WHILE HLA-DRB1*0301, *09 AND *13 POLYMORPHISMS MIGHT DECREASE THE ALOPECIA AREATA RISK PMID: 30095639
  16. Most patients with narcolepsy type I and half of patients with Narcolepsy type II carry HLA-DQB1*0602. HLA-DQB1*0602 forms a heterodimer with HLA-DQA1*0102 and may act as an antigen presenter to the T cell receptors, resulting in Narcolepsy susceptibility. PMID: 28108192
  17. These findings document the protective effect of DRB1*13:02 on age-dependent reduction of brain gray matter in healthy individuals. PMID: 29452862
  18. The mechanism involved in the interaction of HSP60-Ass conjugate with HLA-DR-DRB allele considering the fact that Ass (1-42) is highly immunogenic in human and interactions evoked highly robust T-cell response through MHC class II binding predictions. PMID: 27106586
  19. this study found that allele HLA-DRB1*12 showed a positive association with end-stage renal disease in Dalian Han population located in north of China PMID: 29257902
  20. HLA-DRB1*04 was associated with increased risk for rheumatoid arthritis and ACPA positivity, while HLA-DRB1*07 was associated with reduced risk for RA and rheumatoid factor synthesis in Algerian patients. PMID: 24447879
  21. This study showed that no association was observed between rs1800629 genotypes or HLA-DRB1 alleles and mesial temporal lobe epilepsy with hippocampal sclerosis susceptibility. PMID: 28675059
  22. Polymorphisms in the HLA-DRB1*03 gene are associated with viral load in Hepatitis B virus . PMID: 30045250
  23. DRB1*15 alleles are the first strong risk factor associated to a chronic inflammatory demyelinating polyradiculoneuropathy subset PMID: 29145880
  24. HLA-DRB1 rs13192471 SNP plays a critical role in Rheumatoid arthritis (RA) susceptibility and severity in North-east Indian cases and has prognostic significance in RA. PMID: 29168332
  25. We hypothesize that the protective role of DRB1*13:02 is due to its successful elimination of external antigens to which Gulf War veterans were exposed, antigens that otherwise would persist causing low-grade inflammation and possibly leading to autoimmunity. PMID: 29137891
  26. We did not find significant results of non-additive and interactive effects on ACPA levels. It is compatible that we did not find significant results of non-additive effects in amino acid positions since neither DRB1*09:01 nor DRB1*04:05, the main drivers of ACPA levels, showed non-additive effects. PMID: 29025870
  27. The findings indicate that HLA-DRB1*09:01 and HLA-DRB1*12:01 alleles may contribute to susceptibility of adult DM in Han Chinese population. PMID: 29106035
  28. HLA-DRB1*01, *04, *10 and *14 alleles are related with RA, while HLA-DRB1*03, *07, *11 and *13 protect against rheumatoid arthritis in a South Indian population. PMID: 27943654
  29. The IL-10 and HLA-DRB1*15 polymorphisms were associated with the susceptibility to Multiple sclerosis in Iranian patients. Our results suggest that gene-gene interaction of IL-10 polymorphisms and HLA-DRB1*15 alleles may be important factors in the development of Multiple sclerosis . PMID: 29067976
  30. DRB1*04:01 and *12:02 confer susceptibility to anti-MDA5 antibody production in dermatomyositis, which cannot be explained by the shared epitope hypothesis. PMID: 28711882
  31. HLA-DRB1 alleles are associated with susceptibility to adult onset Still's disease in Japanese subjects. PMID: 28899403
  32. HLA-DRB1*13:02 allele was linked to elevated HIV viral loads, while HLA-DRB1*12:01 allele showed significantly lower viral set points. PMID: 28677168
  33. the interaction between the HLA-DRB1*1501 allele and MBP gene may be considered as a predisposing factor in the development and pathogenesis of multiple sclerosis in the case of gene-gene interaction PMID: 28919586
  34. genetic association studies in cohort in Denmark: Data suggest that standard immunosuppression treatment failure in patients with autoimmune hepatitis is not associated with thiopurine S-methyltransferase genetic variants or HLA-DRB1*03 genotype in the population studied. PMID: 28374975
  35. Review/Meta-analysis: Report association of HLA-DRB1 alleles with rheumatoid arthritis among Arabs. PMID: 27412376
  36. HLA association analysis of patients infected with modern MTB strains showed significant association for HLA-DRB1*09:01 (odds ratio [OR] = 1.82; P-value = 9.88 x 10(-4) ) and HLA-DQB1*03:03 alleles (OR = 1.76; P-value = 1.31 x 10(-3) ) with susceptibility to TB. Haplotype analysis confirmed that these alleles were in strong linkage disequilibrium and did not exert an interactive effect. PMID: 28612994
  37. The risk of actinic prurigo associated with HLA-DRB1*03:01 in Chinese patients living in Singapore is reported. PMID: 26787110
  38. These results have shown a strong association of HLA-DRB1*03 with MG, especially for EOMG also in our population. HLA-DRB1*01 was associated to LOMG suggesting that is a susceptibility factor for this subgroup of the disease. PMID: 28495048
  39. There are hundreds of polymorphisms of HLA-DRB1 which have been associated with different autoimmune disorders as well as with immune response to infection and vaccines. It is possible that the interaction of specific HLA with pathogenic antigens is one of the keys favoring (or protecting) toward the development of an autoimmune disease.[Review] PMID: 27435705
  40. Suggest an independent leading contribution of rs17879599 in the 2nd exon of HLA-DRB1 gene to hepatocellular carcinoma risk in Han Chinese. PMID: 27821814
  41. None of the 13 individuals with the rs7903146 TT genotype carried the highest Type 1 diabetes risk HLA genotype, i.e. DRB1*03:01/DR4 (DRB1*0401, *04:05 or *04:02), compared with 29.4% (27/92) of those without it (P=0.023). The DRB1*03:01 allele was present in 15.4% (2/13) of individuals with the single nucleotide polymorphism, compared with 59.8% (55/92) of those without it (P=0.003). PMID: 27027642
  42. the 'GG/G' of CTLA4 +49AG SNP, HLA-DRB1*11/-DRB1*12 (DR5) alleles and the combinations of DRB1*11/DRB1*12 alleles with AG/GG genotype and DRB1*04/07/12 alleles with GG genotype may act as synergistic manner to confer the strong susceptibility to autoimmune thyroid diseases in south India PMID: 29174716
  43. Our meta-analysis showed four main findings regarding the HLA-DRB1 locus as a genetic risk factor of juvenile idiopathic arthritis. PMID: 29037901
  44. IFNL3 and HLA-DPB1 independently affected viral control at 3- and 6-mo postpartum. Together, these findings support a model where spontaneous control of HCV such as sometimes follows pregnancy is governed by genetic polymorphisms that affect type III IFN signaling and virus-specific cellular immune responses. PMID: 27601657
  45. HLA-DRB1*15 modifies the association of vitamin D status with relapse rate in pediatric MS. PMID: 26769066
  46. HLA-DRB1*10 is associated with rheumatoid arthritis while HLA-DRB1*13 and HLA-DRB1*14 alleles confer protection in South Indian Tamils. PMID: 27753285
  47. DNA Methylation differences at the HLA-DRB1 locus in CD4+ T-Cells are associated with the development multiple sclerosis PMID: 24336351
  48. In particular, tryptophan at position 9 (outside the shared epitope) represented significant association with RA-ILD (OR = 22.89, 95 % CI = 1.20-432.56, p = 0.037) compared with the carriers of non-tryptophan amino acids. PMID: 27372294
  49. Systemic sclerosis patients differed from controls when DRB1 alleles were categorized according to 3rd hypervariable region sequences PMID: 28270189
  50. these findings support the hypothesis that exposure to the fetus influences a mother's risk of disease. This is the first study to demonstrate an association between a child's DRB1 genotype and risk of SLE in the mother. PMID: 27388144

Show More

Hide All

Subcellular Location Cell membrane, Single-pass type I membrane protein, Endoplasmic reticulum membrane, Single-pass type I membrane protein, Golgi apparatus, trans-Golgi network membrane, Single-pass type I membrane protein, Endosome membrane, Single-pass type I membrane protein, Lysosome membrane, Single-pass type I membrane protein, Late endosome membrane, Single-pass type I membrane protein
Protein Families MHC class II family
Database Links

HGNC: 4948

OMIM: 142857

UniGene: Hs.485130

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2021 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1